Protein Info for MPMX20_00190 in Enterobacter sp. TBS_079

Annotation: Periplasmic dipeptide transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00496: SBP_bac_5" amino acids 73 to 453 (381 residues), 379 bits, see alignment E=1.3e-117

Best Hits

Swiss-Prot: 91% identical to DPPA_ECOLI: Periplasmic dipeptide transport protein (dppA) from Escherichia coli (strain K12)

KEGG orthology group: K12368, dipeptide transport system substrate-binding protein (inferred from 99% identity to enc:ECL_00229)

MetaCyc: 91% identical to dipeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>MPMX20_00190 Periplasmic dipeptide transport protein (Enterobacter sp. TBS_079)
MSISLKKSGMLKLGLSLVAMTVAASVQAKTLVYCSEGSPEGFNPQLFTSGTTYDASSVPI
YNRLVEFKTGTTEVIPGLAEKWDVSEDGKTYTFHLRQGVKWQDNKEFKPTRDFNADDVVF
SFDRQKNAQNPYHKVSGGSYEYFEGMGLQDLIAEVKKVDDKTVQFVLTRPEAPFLADLAM
DFASILSKEYADNMLKAGTPEKVDLNPIGTGPFQLLQYQKDSRILYKAFPGFWGTKPQID
RLVFSITPDASVRYAKLQKNECQVMPYPNPADIARMKQDKNINLLEQAGLNVGYLSFNTE
KKPFDDVKVRQALTYAVNKEAIIKAVYQGAGVAAKNLIPPTMWGYNDDVKDYTYDPEKAK
ALLKEAGQEKGFTVELWAMPVQRPYNPNARRMAEMVQADWAKVGVQAKIVTYEWGEYLKR
AKAGEHQAVMMGWTGDNGDPDNFFATLFSCAAAKDGSNYSRWCYKPFEDLIQPARATDDH
NKRIELYKQAQVVMHDQAPALIVAHSTVYEPVRKEVKGYVVDPLGKHHFENVSVE