Protein Info for MPMX20_00161 in Enterobacter sp. TBS_079

Annotation: Xylose operon regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13407: Peripla_BP_4" amino acids 73 to 257 (185 residues), 40.5 bits, see alignment E=4.9e-14 PF13377: Peripla_BP_3" amino acids 113 to 277 (165 residues), 119.7 bits, see alignment E=2.9e-38 PF00165: HTH_AraC" amino acids 294 to 335 (42 residues), 34 bits, see alignment 4.9e-12 amino acids 347 to 384 (38 residues), 44.8 bits, see alignment 2e-15 PF12833: HTH_18" amino acids 310 to 386 (77 residues), 73.6 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 89% identical to XYLR_ECOL6: Xylose operon regulatory protein (xylR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to enc:ECL_00197)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>MPMX20_00161 Xylose operon regulatory protein (Enterobacter sp. TBS_079)
MFEKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIEEDFRTRLENIKEWLGDGV
IADYDDPVIEQLLTDVDVPIVGVGGSYHAPEHYPPVHYIATDNHALVETAFLHLKEKGVH
RFAFYGLPSTSGKRWAVEREHAFCQLVAQEKYRGVVYQGLETAPENWQHAQNRLADWLQT
LPPQTGIIAVTDARARHVLQVCEHLHIPVPEKLCVIGIDNEELTRYLSRVALSSVAQGTR
QMGYQAAKLLHRLLDKEALPLQRLLVPPVRVVERRSTDYRSLSDPAVIQAMHYIRNNACK
GIKVDQVLDSVGISRSNLEKRFKEEVGETIHAVIHAEKLEKARSLLISTSLSINEISQMC
GYPSLQYFYSVFRKEYESTPKEYRERHSEVMM