Protein Info for MPMX20_00097 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR00608: DNA repair protein RadC" amino acids 29 to 241 (213 residues), 288.7 bits, see alignment E=1.6e-90 PF20582: UPF0758_N" amino acids 29 to 96 (68 residues), 70.3 bits, see alignment E=1.2e-23 PF04002: RadC" amino acids 122 to 240 (119 residues), 155.1 bits, see alignment E=7.9e-50

Best Hits

Swiss-Prot: 76% identical to Y101_ENT38: UPF0758 protein Ent638_0101 (Ent638_0101) from Enterobacter sp. (strain 638)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 89% identity to enc:ECL_00123)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>MPMX20_00097 hypothetical protein (Enterobacter sp. TBS_079)
MGVERRGGLWQHDGKPKETGMEETELLLPREKMLRYGVTLLKDDELLALFLRTGTPGKTV
FTLAKELIDHFGSLYGLLTADLTEFRHVEGIGVAKFAQLRGIAELARRFYDVRMEEEDPI
LTPDMTRVFLQSQLSDLEREIFMVIFLDNRNRVLKHSRLFSGTLSHVEVHPREIVREAIK
VNAAGVILAHNHPSGCAEPSRADKEMTERIIKCCQFMDIRVLDHLIIGRGEYISFAEHGW
I