Protein Info for MPMX20_00021 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YidH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details PF02656: DUF202" amino acids 13 to 80 (68 residues), 70.9 bits, see alignment E=5.2e-24

Best Hits

Swiss-Prot: 87% identical to YIDH_SHIFL: Inner membrane protein YidH (yidH) from Shigella flexneri

KEGG orthology group: K00389, putative membrane protein (inferred from 96% identity to enc:ECL_00021)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>MPMX20_00021 Inner membrane protein YidH (Enterobacter sp. TBS_079)
MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPLIREVLALLLC
LFAGVLAIYGYLRWLRNEKAMRLKQDLPYTRGLLIISMILLAVAGVVMVLVLYGG