Protein Info for MMP_RS08915 in Methanococcus maripaludis S2

Annotation: 2 5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13155: Toprim_2
  • amino acids 27 to 103 (77 residues), 39.2 bits, E=1.5e-13
• PF13662: Toprim_4
  • amino acids 27 to 101 (75 residues), 32.9 bits, E=1.2e-11
• PF01751: Toprim
  • amino acids 27 to 95 (69 residues), 35.7 bits, E=1.6e-12
• TIGR00227: riboflavin-specific deaminase C-terminal domain
  • amino acids 138 to 354 (217 residues), 259.2 bits, E=2.8e-81
• PF01872: RibD_C
  • amino acids 140 to 351 (212 residues), 208.2 bits, E=2.2e-65
• TIGR01508: diaminohydroxyphosphoribosylaminopyrimidine reductase
  • amino acids 140 to 354 (215 residues), 284.7 bits, E=3.2e-89

Best Hits

KEGG orthology group: K14654, 2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase [EC: 1.1.1.302] (inferred from 100% identity to mmp:MMP1348)

Predicted SEED Role

"Small primase-like proteins (Toprim domain) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193)

MetaCyc Pathways

• flavin biosynthesis II (archaea) (8/10 steps found)
• flavin biosynthesis I (bacteria and plants) (6/9 steps found)
• flavin biosynthesis III (fungi) (5/9 steps found)
• toxoflavin biosynthesis (2/7 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.193 or 1.1.1.302

Sequence Analysis Tools

See Q6LXK2 at UniProt or InterPro

Protein Sequence (360 amino acids)

>MMP_RS08915 2 5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase (Methanococcus maripaludis S2)
MDKQESLEKLLLIIDDLKSLAENGIPILVEGPNDILSLKNLKIRANFITVSNTSVFQIAD
DLIAKNISEVILLTDFDRAGREYAKNIMEEFQSRGIKVNNLIRKEILKYSRGDLKDIESL
YPYISRRINFNSDLSDIMLPFVISNVGMTLDGKLATIDNDSRISGENDLKRVHEIRKEVD
AIMVGIGTVLKDDPRLTVHKINASPKDNPLRIVVDSNLKIPLTARVLNKDAKTVIATTTP
ISDEKEEKIRKLNEMGIIVLQAGVQKVDLRKIMNEIYKMGINKILLEGGGTLNWGMFKEN
LINEVRVYIAPKVFGGASSPTYVDGNGFKNVEECTKLELKNYYPLDDGIVLEYHVIGSFE