Protein Info for MMP_RS08885 in Methanococcus maripaludis S2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13174: TPR_6" amino acids 34 to 59 (26 residues), 14.4 bits, see alignment 3.7e-05 PF21033: RMD1-3" amino acids 41 to 94 (54 residues), 29.4 bits, see alignment E=3.2e-10 PF13181: TPR_8" amino acids 42 to 60 (19 residues), 21 bits, see alignment (E = 1.9e-07) amino acids 66 to 94 (29 residues), 23.5 bits, see alignment 3e-08 amino acids 97 to 127 (31 residues), 12.8 bits, see alignment 8.4e-05 amino acids 131 to 161 (31 residues), 25.8 bits, see alignment 5.6e-09 PF13176: TPR_7" amino acids 63 to 92 (30 residues), 18.6 bits, see alignment 1.1e-06 PF13431: TPR_17" amino acids 84 to 113 (30 residues), 25.7 bits, see alignment 6.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0762)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ67 at UniProt or InterPro

Protein Sequence (174 amino acids)

>MMP_RS08885 tetratricopeptide repeat protein (Methanococcus maripaludis S2)
MNRILLIFLILMSTCFAGCFEQNNLEKSQEMAEIGFAYIGIDNDKAIEYYEKAIKLNPDD
ANAISFLGTLYDGEGDREKAYEYLTKALEMEPKNPWMYYNLGLYYLNHDDNMAIGCFEKA
LRIDPENECCWSQLGYTYYDIGDYTNSKLNFEKAYEINPKDQYSDMIEKCNEGI