Protein Info for MMP_RS08840 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF01209: Ubie_methyltran" amino acids 151 to 300 (150 residues), 32.1 bits, see alignment E=3.4e-11 PF13489: Methyltransf_23" amino acids 166 to 302 (137 residues), 34.4 bits, see alignment E=8.1e-12 PF01135: PCMT" amino acids 171 to 240 (70 residues), 28.4 bits, see alignment E=6.4e-10 PF05175: MTS" amino acids 173 to 305 (133 residues), 23.9 bits, see alignment E=1.3e-08 PF13847: Methyltransf_31" amino acids 179 to 299 (121 residues), 58.6 bits, see alignment E=3e-19 PF13649: Methyltransf_25" amino acids 184 to 278 (95 residues), 43.6 bits, see alignment E=1.8e-14 PF08242: Methyltransf_12" amino acids 185 to 280 (96 residues), 48.1 bits, see alignment E=7.2e-16 PF08241: Methyltransf_11" amino acids 185 to 282 (98 residues), 46.8 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 47% identical to Y906_METJA: Uncharacterized protein MJ0906 (MJ0906) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mmp:MMP1717)

Predicted SEED Role

"Methyltransferase MJ0906"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWJ2 at UniProt or InterPro

Protein Sequence (343 amino acids)

>MMP_RS08840 class I SAM-dependent methyltransferase (Methanococcus maripaludis S2)
MLSENNILKYGSNFSKANASSLNNKINSLNYTVEYINNELMGIFFRQGLKFGIFKAVEDF
RPTISELITILGYPNEEFVEKYIKTAVSLNLLNLNEEERLELNSDFIYSSIHPEYDKIIS
DHVSRYDFMSGLVQYAFIGYDHPEILLNFKKDADIWDMMLNTKYMKTCREVISEYLDIKN
GDTILEVGCGSRSPLYFASKVAPNGEYVGVDISKKLIRVAQGRLKRSGIECAKLKALDFS
ETIAKNKHDYVLCIHTLSYADSLKLFLKKMMGSLRKGGKLVIMEEFFTENINTNAELFEF
YNHLNKYFKNYVSKTEILKELELIGIDYKYELLGDNCIVVERI