Protein Info for MMP_RS08835 in Methanococcus maripaludis S2

Annotation: H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR01724: H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein" amino acids 1 to 341 (341 residues), 571.4 bits, see alignment E=3e-176 PF03446: NAD_binding_2" amino acids 32 to 120 (89 residues), 25.3 bits, see alignment E=2.1e-09 PF22616: HMD_N" amino acids 65 to 184 (120 residues), 49.5 bits, see alignment E=5.8e-17 PF03201: HMD" amino acids 194 to 289 (96 residues), 134.2 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 71% identical to HMDY_METJA: H(2)-forming methylenetetrahydromethanopterin dehydrogenase-related protein MJ1338 (MJ1338) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00319, methylenetetrahydromethanopterin dehydrogenase [EC: 1.5.99.9] (inferred from 100% identity to mmp:MMP1716)

Predicted SEED Role

"H(2)-dependent methylenetetrahydromethanopterin dehydrogenase related protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.99.9

Use Curated BLAST to search for 1.5.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWJ3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>MMP_RS08835 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein (Methanococcus maripaludis S2)
MKVTVYGAGNQNLYVNQLNLPGTYGGVPPYGGSRMAIEFAKAGHDVILAEVNKSNLTDEQ
WKIVEEAGVKVLTDDAEAAKEAEIAIFFTPFGKKTVEIAKTILPHLPQNAIIANTCTVSP
VILYTMLEVELRTKRKDIGITSMHPAAVPGTPQHGHYVISSKATNGTEYASDEQIEKCVK
LTESIEKTPYLVPADVSATVSDMGSLLTAVTLAGVLDYYSVGTKVIKAPKKMVEQQILMT
LQTMASLVESSGVDGLVKALNPELLSKAASSMHLLDQQKDLDAALEILTHLDGELEKAST
VAEIKPTTLVAAQSLVKELETLIGGAAANGAIKRSTKKLFQ