Protein Info for MMP_RS08785 in Methanococcus maripaludis S2
Annotation: RNA-protein complex protein Nop10
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NOP10_METMP: Ribosome biogenesis protein Nop10 (nop10) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K07563, ribosome biogenesis protein Nop10 (inferred from 94% identity to mmz:MmarC7_0981)Predicted SEED Role
"Ribosome biogenesis protein Nop10"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LWK3 at UniProt or InterPro
Protein Sequence (51 amino acids)
>MMP_RS08785 RNA-protein complex protein Nop10 (Methanococcus maripaludis S2) MKMKKCPKCGKYTLKDFCSECNEKSVTVKPPRFSPVDKYGKYRRALKKAKM