Protein Info for MMP_RS08745 in Methanococcus maripaludis S2

Annotation: CDP-2 3-bis-(O-geranylgeranyl)-sn-glycerol synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CDPAS_METMP: CDP-archaeol synthase (carS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1698)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

CDP-diacylglycerol biosynthesis I (1/4 steps found)
CDP-diacylglycerol biosynthesis II (1/4 steps found)
phosphatidylglycerol biosynthesis I (2/6 steps found)
phosphatidylglycerol biosynthesis II (2/6 steps found)
CDP-diacylglycerol biosynthesis III (1/5 steps found)
superpathway of phospholipid biosynthesis III (E. coli) (3/12 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (3/13 steps found)
type I lipoteichoic acid biosynthesis (S. aureus) (3/17 steps found)
superpathway of phospholipid biosynthesis II (plants) (3/28 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWL1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>MMP_RS08745 CDP-2 3-bis-(O-geranylgeranyl)-sn-glycerol synthase (Methanococcus maripaludis S2)
MDLLLLLFSALWYILPAYVANAVPCILGGGKPVDFGKNFFDGNRIIGNGVTYRGTFFGIL
FGIITGILQHFIVILYMGPKSVFNYGLTGYIILSFLLATGALFGDMLGSFIKRRFNLNQG
QSAPLLDQITFIIFALLFAYSLYPVPANIIVLLLVISPIIHFSSNIIAYKLHLKKVWW