Protein Info for MMP_RS08735 in Methanococcus maripaludis S2

Annotation: hydrogenase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02662: FlpD
  • amino acids 15 to 128 (114 residues), 120.1 bits, E=3e-39

Best Hits

Swiss-Prot: 100% identical to VHUD_METMP: F420-non-reducing hydrogenase vhu iron-sulfur subunit D (vhuD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K14127, F420-non-reducing hydrogenase iron-sulfur subunit D [EC: 1.12.99.-] (inferred from 100% identity to mmp:MMP1696)

MetaCyc: 54% identical to MvhD (Moorella thermoacetica)
1.5.1.M4 [EC: 1.5.1.M4]

Predicted SEED Role

"CoB--CoM-reducing hydrogenase (Sec) delta subunit @ selenocysteine-containing"

MetaCyc Pathways

• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.-

Use Curated BLAST to search for 1.12.99.- or 1.5.1.M4

Sequence Analysis Tools

See Q6LWL3 at UniProt or InterPro

Protein Sequence (134 amino acids)

>MMP_RS08735 hydrogenase iron-sulfur subunit (Methanococcus maripaludis S2)
MAEPVIMAFVCYQ*GYGAADLAGTSRMQYPASVRAIRVPCTGKFDITYALRAFQKGADAV
FVAG*KPNECAFETGNFKAEERVKFGKQILDELGIGGERLEMFFMSGADAGKFTEAVKEM
TDRVKKLGPNPIKA