Protein Info for MMP_RS08720 in Methanococcus maripaludis S2

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00037: Fer4
  • amino acids 5 to 27 (23 residues), 24.6 bits, see alignment (E = 1.1e-08)
  • amino acids 130 to 148 (19 residues), 24.1 bits, see alignment (E = 1.5e-08)
  • amino acids 154 to 175 (22 residues), 28.6 bits, see alignment (E = 5.9e-10)
  • amino acids 193 to 214 (22 residues), 28 bits, see alignment (E = 9.2e-10)
  • amino acids 226 to 245 (20 residues), 22.3 bits, see alignment (E = 5.6e-08)
  • amino acids 262 to 284 (23 residues), 26.1 bits, see alignment (E = 3.7e-09)
  • amino acids 307 to 324 (18 residues), 26.1 bits, see alignment (E = 3.6e-09)
  • amino acids 339 to 358 (20 residues), 23 bits, see alignment (E = 3.5e-08)
• PF12800: Fer4_4
  • amino acids 32 to 47 (16 residues), 11.4 bits, see alignment (E = 0.00026)
  • amino acids 90 to 103 (14 residues), 10.5 bits, see alignment (E = 0.00048)
  • amino acids 131 to 144 (14 residues), 12.6 bits, see alignment (E = 0.0001)
  • amino acids 197 to 210 (14 residues), 18.5 bits, see alignment (E = 1.3e-06)
  • amino acids 226 to 241 (16 residues), 11 bits, see alignment (E = 0.00033)
  • amino acids 307 to 321 (15 residues), 15.2 bits, see alignment (E = 1.5e-05)
  • amino acids 342 to 357 (16 residues), 16.4 bits, see alignment (E = 6.4e-06)
• PF12838: Fer4_7
  • amino acids 33 to 77 (45 residues), 28.7 bits, 9.9e-10
  • amino acids 90 to 146 (57 residues), 34.7 bits, E=1.3e-11
  • amino acids 159 to 210 (52 residues), 39.3 bits, 4.7e-13
  • amino acids 229 to 282 (54 residues), 32.5 bits, 6.5e-11
  • amino acids 308 to 358 (51 residues), 42.2 bits, 6.1e-14
• PF13187: Fer4_9
  • amino acids 90 to 147 (58 residues), 29.4 bits, E=4.4e-10
  • amino acids 198 to 243 (46 residues), 30.2 bits, 2.4e-10
  • amino acids 307 to 358 (52 residues), 31 bits, 1.3e-10
• PF14697: Fer4_21
  • amino acids 153 to 210 (58 residues), 40.2 bits, E=2e-13
  • amino acids 194 to 245 (52 residues), 39.2 bits, 4.1e-13
• PF13237: Fer4_10
  • amino acids 154 to 210 (57 residues), 36.9 bits, E=1.9e-12
  • amino acids 194 to 240 (47 residues), 27.9 bits, 1.3e-09
  • amino acids 305 to 356 (52 residues), 25.6 bits, 6.3e-09
  • amino acids 339 to 384 (46 residues), 25.1 bits, 9.6e-09
• PF12798: Fer4_3
  • amino acids 160 to 174 (15 residues), 13.3 bits, see alignment (E = 8.8e-05)
  • amino acids 199 to 210 (12 residues), 12.9 bits, see alignment (E = 0.00011)
  • amino acids 345 to 357 (13 residues), 15.2 bits, see alignment (E = 2.2e-05)

Best Hits

Swiss-Prot: 76% identical to VHUB_METVO: Polyferredoxin protein VhuB (vhuB) from Methanococcus voltae

KEGG orthology group: K05912, [EC: 1.12.-.-] (inferred from 100% identity to mmp:MMP1692)

Predicted SEED Role

"CoB--CoM-reducing hydrogenase (Sec) beta subunit" in subsystem H2:CoM-S-S-HTP oxidoreductase

Isozymes

Compare fitness of predicted isozymes for: 1.12.-.-

Use Curated BLAST to search for 1.12.-.-

Sequence Analysis Tools

See Q6LWL7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>MMP_RS08720 4Fe-4S binding protein (Methanococcus maripaludis S2)
LAGISIQEDACLVCNACAKACPTEAIEIAPFKTCIQCFSCATACPTGALVEKDGKLVFNG
SKCDLDGACQKACPVGIKKVDDRFPYSKGHCVLCEKCVEICPAEIISLPGKAEKPKKEII
IPQEPIAVTKDCVACGVCVPECPVDAISIEDIAVIDTDKCIYCTVCSQTCPWNAIFVAGK
LPQKRQKTIKSFTVNEEECIGCEKCVEACPGSMIEYNGEKLGVKLPEACPACGLCVESCP
VEVISLEVEYASAKPVTDEGLVWSEEKCAYCGPCAIKCPTGAIKVVNPKGLELPSKKKTE
KANEFAMCIRCGACAMKCPTGALKMGKMVHEGKEYARVEFSPALCNECGECVDVCPQKTL
ELTGDDKMPLKGYCVMCLKCIEACNKTKKEALSLK