Protein Info for MMP_RS08705 in Methanococcus maripaludis S2

Annotation: sulfopyruvate decarboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03846: sulfopyruvate decarboxylase, beta subunit
  • amino acids 5 to 184 (180 residues), 262 bits, E=1.5e-82
• PF02775: TPP_enzyme_C
  • amino acids 43 to 155 (113 residues), 59.9 bits, E=1.3e-20

Best Hits

Swiss-Prot: 100% identical to COME_METMP: Sulfopyruvate decarboxylase subunit beta (comE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K13039, sulfopyruvate decarboxylase subunit beta [EC: 4.1.1.79] (inferred from 100% identity to mmp:MMP1689)

MetaCyc: 56% identical to beta subunit of sulfopyruvate decarboxylase (Methanocaldococcus jannaschii)
Sulfopyruvate decarboxylase. [EC: 4.1.1.79]

Predicted SEED Role

"Sulfopyruvate decarboxylase - beta subunit (EC 4.1.1.79)" (EC 4.1.1.79)

MetaCyc Pathways

• coenzyme M biosynthesis I (4/7 steps found)
• sulfolactate degradation II (1/4 steps found)
• coenzyme M biosynthesis II (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.79

Use Curated BLAST to search for 4.1.1.79

Sequence Analysis Tools

See Q6LWM0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>MMP_RS08705 sulfopyruvate decarboxylase subunit beta (Methanococcus maripaludis S2)
MELTRYEIIKILMEYVTDEIVVCNIGIPSKELFKINDREKNFYMLGSMGLSSSIGHGLAL
SVNEKVIAIDGDGSVLMNMGSLATIGKTTPKDFLLLIVDNCAYGSTGNQETHSTCTDLYQ
VSKACGIDSIGVFNEEQLRDAVKLALSESGTKVIVAKARPHNENVPNINLVPTEIKHRFM
NAIKK