Protein Info for MMP_RS08640 in Methanococcus maripaludis S2

Annotation: TIM barrel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF01261: AP_endonuc_2" amino acids 21 to 258 (238 residues), 87.1 bits, see alignment E=1.6e-28 PF03851: UvdE" amino acids 38 to 214 (177 residues), 24.4 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 58% identical to Y133_METJA: Uncharacterized protein MJ0133 (MJ0133) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01151, deoxyribonuclease IV [EC: 3.1.21.2] (inferred from 100% identity to mmp:MMP1678)

Predicted SEED Role

"Endonuclease IV (EC 3.1.21.2)" in subsystem DNA repair, bacterial (EC 3.1.21.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWN1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>MMP_RS08640 TIM barrel protein (Methanococcus maripaludis S2)
MLKFGTAGIPINAKNTESALEYLKEIKLDAMELEFVRGVNLKAEKAESLAKNLKITLSAH
APYYINLNAKEPEKIESSIKRIVDSAKIISIFNKKNSENKNVVFHSGFYLKQDKDLVYEK
IKVNIQKILKIMDENKINAILRPETTGKISQFGSIDELIQLSTEIDIMPCIDFSHVYARS
LGKINDYDSFSNILSKLENNLGKKGIKDMHIHISGIDFGNGGEKKHFPILNSEFNYMAVL
KALKDFECSGTVICESPKLEYDAVILKKNYEEL