Protein Info for MMP_RS08585 in Methanococcus maripaludis S2

Annotation: flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 12 to 14 (3 residues), see Phobius details transmembrane" amino acids 15 to 35 (21 residues), see Phobius details TIGR02537: archaeal flagellin N-terminal-like domain" amino acids 10 to 33 (24 residues), 28.1 bits, see alignment (E = 5.9e-11) PF01917: Arch_flagellin" amino acids 12 to 202 (191 residues), 160.3 bits, see alignment E=2.4e-51

Best Hits

Swiss-Prot: 67% identical to FLAB2_METVO: Flagellin B2 (flaB2) from Methanococcus voltae

KEGG orthology group: K07325, archaeal flagellin FlaB (inferred from 100% identity to mmp:MMP1667)

Predicted SEED Role

"Flagellin FlaB2" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWP2 at UniProt or InterPro

Protein Sequence (216 amino acids)

>MMP_RS08585 flagellin (Methanococcus maripaludis S2)
MKITEFMKSKKGASGIGTLIVFIAMVLVAAVAASVLINTSGFLQQKASTTGKDSTEQVAS
GLQIMGISGYQAGTANANITKLAIYITPNAGSAAIDMNQVVLTLSDGTTKTVTKYDTTAY
TNLTAGGDLYNTTTVNWSKLADTTEFGIVEIQDADLSFTSSAPVINKGDIVAIIVSGVSF
DTRMEISGTVQPEFGAPGVISFTTPSTFTEKVVSLQ