Protein Info for MMP_RS08545 in Methanococcus maripaludis S2

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR00670: aspartate carbamoyltransferase" amino acids 2 to 297 (296 residues), 395.5 bits, see alignment E=7.2e-123 PF02729: OTCace_N" amino acids 2 to 143 (142 residues), 168.9 bits, see alignment E=8e-54 PF00185: OTCace" amino acids 151 to 295 (145 residues), 95 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 100% identical to PYRB_METMP: Aspartate carbamoyltransferase (pyrB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to mmp:MMP1659)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.2

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWQ0 at UniProt or InterPro

Protein Sequence (302 amino acids)

>MMP_RS08545 aspartate carbamoyltransferase (Methanococcus maripaludis S2)
MRHLISMRDIGREEILNILDESERMEAILNEKGHCDFLNGRILATLFYEPSTRTRLSFET
AMKRLGGNVIGFTDISNTSVTKGESLADTIKVISGYSDLIAIRHPSEGAARLSSENSKVP
VINAGDGSNQHPTQTLLDLYTIKREVGHIENLKIAFIGDLKYGRTVHSLCQALSLFKGVE
IKLISPDELKMPREVIEDIAGKIKLSEMADVDIDDVDVVYMTRIQKERFVDVNEYYKVKG
IYRLSKEHIGEKNVVIMHPLPRVDEIDSEVDNIPQARYFKQSFYGVPVRMAILKLLFEDS
VK