Protein Info for MMP_RS08500 in Methanococcus maripaludis S2

Annotation: pyridoxal 5'-phosphate synthase glutaminase subunit PdxT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR03800: pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2" amino acids 4 to 180 (177 residues), 195.1 bits, see alignment E=5.1e-62 PF01174: SNO" amino acids 6 to 185 (180 residues), 206.5 bits, see alignment E=3.4e-65 PF00117: GATase" amino acids 35 to 169 (135 residues), 36.3 bits, see alignment E=4.7e-13

Best Hits

Swiss-Prot: 100% identical to PDXT_METMP: Pyridoxal 5'-phosphate synthase subunit PdxT (pdxT) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K08681, glutamine amidotransferase [EC: 2.6.-.-] (inferred from 100% identity to mmp:MMP1656)

MetaCyc: 42% identical to 2-deoxy-scyllo-inosose synthase 23 kDa subunit (Niallia circulans)

Predicted SEED Role

"Pyridoxine biosynthesis glutamine amidotransferase, glutaminase subunit (EC 2.4.2.-)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 2.6.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0C036 at UniProt or InterPro

Protein Sequence (187 amino acids)

>MMP_RS08500 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT (Methanococcus maripaludis S2)
MKIIGILGIQGDIEEHEDAVKKINCIPKRIRTVDDLEGIDALIIPGGESTTIGKLMVSYG
FIDKIRNLKIPILGTCAGMVLLSKGTGKEQPLLEMLNVTIKRNAYGSQKDSFEKEIDLGG
KKINAVFIRAPQVGEILSKDVEIISKDDENIVGIKEGNIMAISFHPELSDDGVIAYEYFL
KNFVEKR