Protein Info for MMP_RS08460 in Methanococcus maripaludis S2

Annotation: proteasome-activating nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR01242: 26S proteasome subunit P45 family" amino acids 28 to 388 (361 residues), 617.8 bits, see alignment E=3.3e-190 PF16450: Prot_ATP_ID_OB_C" amino acids 73 to 127 (55 residues), 45 bits, see alignment 2.8e-15 PF17758: Prot_ATP_ID_OB_N" amino acids 73 to 128 (56 residues), 24.7 bits, see alignment 5.2e-09 PF07728: AAA_5" amino acids 184 to 302 (119 residues), 31.5 bits, see alignment E=5.6e-11 PF07724: AAA_2" amino acids 185 to 279 (95 residues), 27.7 bits, see alignment E=9.2e-10 PF00004: AAA" amino acids 185 to 317 (133 residues), 158.1 bits, see alignment E=5.7e-50 PF17862: AAA_lid_3" amino acids 340 to 383 (44 residues), 53.7 bits, see alignment 4e-18

Best Hits

Swiss-Prot: 100% identical to PAN_METMP: Proteasome-activating nucleotidase (pan) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03420, proteasome regulatory subunit (inferred from 100% identity to mmp:MMP1647)

Predicted SEED Role

"Proteasome-activating AAA-ATPase (PAN), archaeal" in subsystem Proteasome archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWR0 at UniProt or InterPro

Protein Sequence (407 amino acids)

>MMP_RS08460 proteasome-activating nucleotidase (Methanococcus maripaludis S2)
MSYPDDYSTDIEKNKMDLKEFKEKTQIAELESKVLRLELKNKDINRENVQIKKENEILKR
ELDKLRIPPLILGTILDKVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTL
AIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIV
PPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEK
SPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDIL
DPAILRPGRFDRIIEISMPDEDGRLEILKIHTEKMNLKGVDLREVAKIAENMVGADLKAV
CTEAGMFAIREEREFIKMDDFREAISKITGKKEKCSYDMPQLTVMYG