Protein Info for MMP_RS08455 in Methanococcus maripaludis S2

Annotation: multiprotein bridging factor aMBF1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00270: TIGR00270 family protein" amino acids 1 to 156 (156 residues), 134 bits, see alignment E=1.9e-43 PF13560: HTH_31" amino acids 74 to 127 (54 residues), 27.1 bits, see alignment E=8.4e-10 PF12844: HTH_19" amino acids 75 to 127 (53 residues), 31.8 bits, see alignment E=2.1e-11 PF01381: HTH_3" amino acids 78 to 130 (53 residues), 48.3 bits, see alignment E=1.7e-16 PF13413: HTH_25" amino acids 79 to 112 (34 residues), 26 bits, see alignment 1.3e-09

Best Hits

KEGG orthology group: K03627, putative transcription factor (inferred from 100% identity to mmp:MMP1646)

Predicted SEED Role

"Uncharacterized HTH-type transcriptional regulator MJ0586"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWR1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>MMP_RS08455 multiprotein bridging factor aMBF1 (Methanococcus maripaludis S2)
MQCELCGKEVKNIIKTRVEGVEMNVCEACAKFGMSPKGYSRKPRAVFKNETKQKQAKRPR
KDMFDNLKTLVEDYGSLVKEAREKKNMTLEELSRAVGIKESLIHKIERNEIEPEEKYVKI
LEKALGISFYEEGDLNYETSNEDSEFTLGDFIKVKKRK