Protein Info for MMP_RS08380 in Methanococcus maripaludis S2

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01569: PAP2
  • amino acids 57 to 179 (123 residues), 95.5 bits, E=1.1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1631)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

• cardiolipin biosynthesis I (1/3 steps found)
• cardiolipin biosynthesis II (1/3 steps found)
• cardiolipin biosynthesis III (1/3 steps found)
• phosphatidylglycerol biosynthesis I (2/6 steps found)
• phosphatidylglycerol biosynthesis II (2/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (3/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (3/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (3/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (3/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

See Q6LWS5 at UniProt or InterPro

Protein Sequence (182 amino acids)

>MMP_RS08380 phosphatase PAP2 family protein (Methanococcus maripaludis S2)
MLIKTLQKTDIDLFYLVNSGVKNPLFDFLTIFISDTVYISILLISYFSFKNDKKVLIQVL
FAMFLLSIFVFAVKYGVSEPRPYEMLEGVILLKNMGTQPSFPSGHTTLAFGFWIIFTRNI
KNSKIISSKKVFEIMIMLLWAFLVAFSRVYVGVHFPHDVLGGMLIGIVFGYIFIRFSEKI
IK