Protein Info for MMP_RS08365 in Methanococcus maripaludis S2

Annotation: energy conserving hydrogenase EhbF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 400 to 423 (24 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details PF10125: NADHdeh_related" amino acids 106 to 249 (144 residues), 47.6 bits, see alignment E=1.5e-16 PF00361: Proton_antipo_M" amino acids 119 to 406 (288 residues), 158.1 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 66% identical to Y1309_METJA: Uncharacterized protein MJ1309 (MJ1309) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14115, energy-converting hydrogenase B subunit F (inferred from 100% identity to mmp:MMP1628)

Predicted SEED Role

"Energy conserving hydrogenase Ehb anchor subunit F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWS8 at UniProt or InterPro

Protein Sequence (482 amino acids)

>MMP_RS08365 energy conserving hydrogenase EhbF (Methanococcus maripaludis S2)
MNLLPLIVVFPMFVAIIFNYLNGKDKLIRPMTLIMAILLLALPFIGSYGIYNFGAHGIEN
GLISGISYLYTPVKQLIITVIMLIGSLVLITGLGEKKSSGLFVALMLMGLASVSAVVMAD
DLFNIYVFYEIAAIAQTGLVIASGTEKAYRSAFRYLILGNFAGSILLLGVSMLLAATGTL
NITDMHNFLLNNPATPTIYGGLLMLIIGLCYGSGLPPFHTVKADIYARAKPHVAAMLQTY
SKFVLVALLLVIFKLFGGLSYFASAHGVLIGLSVLGMVFGVVMALLQTDYKKLLAYHAIS
QGGYVAAGIALGTPLGIVAGIFHAINHVIYKSALFLGAHIVERRKEGNLNKLGGLLPVIP
ATAFMVLCAKLAISGVPPFNGFQSKLLLAEAAMNVNMPELAIIMILVSIGTFVSMMKAFY
LIYLKPCSQEQLEEYKKAKPSKYAVFSLAVLTFLCILLGIFPNLATDIIYPFANEIGRVW
TL