Protein Info for MMP_RS08355 in Methanococcus maripaludis S2

Annotation: Na(+)/H(+) antiporter subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details PF04039: MnhB" amino acids 107 to 234 (128 residues), 79.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 53% identical to Y1307_METJA: Uncharacterized protein MJ1307 (MJ1307) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14118, energy-converting hydrogenase B subunit I (inferred from 100% identity to mmp:MMP1626)

Predicted SEED Role

"Energy conserving hydrogenase Ehb protein H / Energy conserving hydrogenase Ehb protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWT0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>MMP_RS08355 Na(+)/H(+) antiporter subunit B (Methanococcus maripaludis S2)
MTQKREIAVFLSFVFFGSAIIYSLFNINAVEGVNYIYTQNYIVPNLITAVLFDWRGFDTL
GECMILVTSVLVTGMVFGRGLFETEFLKEVYSDSKTESENENGFTSIIKVLAMPFSILLM
ALGISIILGGHITPGGGFQGGSLIAAAYILSIVAFGSKTPIKFKHHFLESLESFGAILFM
SLGVLGIIVSGYYLFNFGDLFGYPVFLSPSGLENTGIIPYLNIAVGLKVLAGLSTITFLL
TGEKVVKDYIVRE