Protein Info for MMP_RS08330 in Methanococcus maripaludis S2

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details PF00146: NADHdh" amino acids 22 to 123 (102 residues), 32.5 bits, see alignment E=3e-12 amino acids 157 to 314 (158 residues), 39.2 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 66% identical to Y1362_METJA: Uncharacterized protein MJ1362 (MJ1362) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14124, energy-converting hydrogenase B subunit O (inferred from 100% identity to mmp:MMP1621)

Predicted SEED Role

"Energy conserving hydrogenase Ehb integral membrane protein O"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWT5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>MMP_RS08330 NADH-quinone oxidoreductase subunit H (Methanococcus maripaludis S2)
MFENILTLETFEIILSMIGIPLIAFAISTWIPGIQRKIQARIQQRKGPSISSPGFWAIFK
YLYKEAKEPVSDLPKLFKFMPLLSFIIVWMVLALTTVVHFHILSNEIGIIGLLKIEEMSY
IIMGSLASTVMGIRMPFIDECKGSGYLKTIKITLGQLSAVRAFKMITVGSFPFYLATLLP
FIPHKSIFLNNLIGNSFLFTLGGLFGALAYIIGYIIMTKDYPFSIMHTKADVIEGPTMEY
SGKYRAFYLSVKELLMITLGSLFATLYLGIAPDILNPITIVMNFAVALVFPIISAVVSAY
TPVFTFRQVYPVSLFATVLGLIGALLALLGV