Protein Info for MMP_RS08320 in Methanococcus maripaludis S2

Annotation: molybdopterin molybdotransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 302 to 324 (23 residues), see Phobius details PF03453: MoeA_N" amino acids 11 to 167 (157 residues), 136.3 bits, see alignment E=1.1e-43 TIGR00177: molybdenum cofactor synthesis domain" amino acids 176 to 320 (145 residues), 106.6 bits, see alignment E=5.7e-35 PF00994: MoCF_biosynth" amino acids 179 to 322 (144 residues), 112.9 bits, see alignment E=1.6e-36 PF03454: MoeA_C" amino acids 333 to 402 (70 residues), 59.5 bits, see alignment E=4.8e-20

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to mmp:MMP1619)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWT7 at UniProt or InterPro

Protein Sequence (402 amino acids)

>MMP_RS08320 molybdopterin molybdotransferase MoeA (Methanococcus maripaludis S2)
MKFVKELISRSDAKNKVFEKFEEMLDDKFENIEINKAFGKICFEDVHAPCNIPMFNRSAM
DGYAVIAEDTFGASQTNPIILNLVKTDSINEEEIYRLSTGMKLPENSNAVVMKEYTKEYD
SFVEIYTGVHPNENVSRIGEDVKTGDLIIKKGELITPYHVALISSLGIKKIKCYSLKIGV
IATGDELLDIEDLESVEQLEKTAMIVNSNSMMVSDLVKETGLSPTAYRKVPDNREELEKA
IKKALLENDIVITTGGTSVGDRDYTIEIIKKIGNIIFHGVQIRPGRPVGFAEAEIDGKKK
LLFVLSGYPVASAVQFELFIANYFKPRKSVKLQINRNIASSLGRTDIVRVKLVEREGFTK
IEPLRITGSGVLSSMTKADGYLMIKENIEGYEKDEFVEVYLF