Protein Info for MMP_RS08315 in Methanococcus maripaludis S2

Annotation: S-methyl-5-thioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 75% identical to MTNA_METJA: Putative methylthioribose-1-phosphate isomerase (MJ0454) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03239, translation initiation factor eIF-2B subunit alpha (inferred from 100% identity to mmp:MMP1618)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

5'-deoxyadenosine degradation I (2/3 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
5'-deoxyadenosine degradation II (1/4 steps found)
L-methionine salvage cycle III (5/11 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (1/7 steps found)
L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
L-methionine salvage cycle II (plants) (2/11 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWT8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>MMP_RS08315 S-methyl-5-thioribose-1-phosphate isomerase (Methanococcus maripaludis S2)
LNKDLRPIIWNDSEKKLVLIDQRKLPNELVYFECKNYKDVCFAIKDMVVRGAPAIGVAAA
YGMALAELNGEDMEKAYLELKKTRPTAVNLFWALEKIIAAKNSGKSLLDEAKLIHEEDIE
LCRKIGEIGEVLIDDFDTILTHCNAGALATSAYGTALSVIRFAHYNGKKINVLSDETRPR
LQGAKLTCFELNYENIPVKAICDNTAGFMMSKGLVDKIIVGADRILSDYHVFNKIGTYSL
AILAKYHNIPFYVAAPYSTFDFESKLEDIVIEERSESEVTHIDNVRIVAEGVSAYNFAFD
CTPPELITGIITEKEIIYPNK