Protein Info for MMP_RS08295 in Methanococcus maripaludis S2

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00442: histidine--tRNA ligase" amino acids 3 to 409 (407 residues), 416.7 bits, see alignment E=1e-128 PF13393: tRNA-synt_His" amino acids 7 to 314 (308 residues), 216.5 bits, see alignment E=1.3e-67 TIGR00443: ATP phosphoribosyltransferase, regulatory subunit" amino acids 9 to 316 (308 residues), 280.3 bits, see alignment E=1.9e-87 PF01409: tRNA-synt_2d" amino acids 17 to 131 (115 residues), 21.5 bits, see alignment E=3.6e-08 PF00587: tRNA-synt_2b" amino acids 62 to 135 (74 residues), 38 bits, see alignment E=4.6e-13 PF03129: HGTP_anticodon" amino acids 329 to 415 (87 residues), 57.7 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 100% identical to SYH_METMP: Histidine--tRNA ligase (hisS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to mmp:MMP1614)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60921 at UniProt or InterPro

Protein Sequence (416 amino acids)

>MMP_RS08295 histidine--tRNA ligase (Methanococcus maripaludis S2)
MFQKPKGTRDFLPEEMKKRKTIEKKLRKVFDSYNFSEINTPTFESFELLSKKTGDEIRTQ
LFVFRDHGDREMGLRPELTSSVARFYINEFKNTPKPVKLYYFTNCFRYENPQAGRYREFW
QMGSELIGSKKPIADAEVVNMAIEGLKEINMDFEIHIGHLGVLKGVFEKYNLSDDEGNEI
RRLIDKEDMDGLKSVLSRLESEKNIEISKKVFEVLDLKGGKEVIPILKEKLADFESSVAA
LENLDSILEFVPHDYVINFGIARGLDYYTGMVFEVYGKKEGAKQVCGGGRYDNLIELFEG
EPSPAVGFAYGFDRIMLNIDDFEVENESIFVVPVKSSEMLLKECLKIAKTLRDSGKSVEV
DLMGRKLNKALNYANTKNIKKVLIVGENDIRDGKVSLKNMETGEQSLIELKDILNI