Protein Info for MMP_RS08230 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02475: Met_10
  • amino acids 4 to 108 (105 residues), 47.5 bits, E=7.5e-16
• PF01135: PCMT
  • amino acids 25 to 92 (68 residues), 23.3 bits, E=2.1e-08
• PF06325: PrmA
  • amino acids 26 to 114 (89 residues), 61.9 bits, E=2.8e-20
• PF00398: RrnaAD
  • amino acids 27 to 100 (74 residues), 31.2 bits, E=5.1e-11
• PF05175: MTS
  • amino acids 34 to 104 (71 residues), 31.5 bits, E=5.3e-11
• PF13847: Methyltransf_31
  • amino acids 34 to 161 (128 residues), 40.1 bits, E=1.3e-13
• PF13649: Methyltransf_25
  • amino acids 38 to 124 (87 residues), 38.7 bits, E=5.4e-13
• PF08241: Methyltransf_11
  • amino acids 40 to 107 (68 residues), 28.9 bits, E=5.7e-10

Best Hits

Swiss-Prot: 58% identical to Y1452_METJA: Uncharacterized protein MJ1452 (MJ1452) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1601)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q6LWV3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>MMP_RS08230 50S ribosomal protein L11 methyltransferase (Methanococcus maripaludis S2)
VELKLSVPQWHYSMLLDDERVSVFKEAVETSVKPGDIVFDLGTGSGILAMIAAKNAKHVY
AVELDPITTEYTRENIKENNYDNITVIEDDAAYYPFSEKADVVIAELLDTGLITEPQVPV
LNSIIEKGLLKEGGLIIPEEVYNSAQLVKSKMGHIYYDEEVTSEEVSNEIVYDTINFYQV
NDEDVEYLLDFELKEDVKNPAVRLNTYTKLKENFISGASPMLNPPLVIPINGKLTAGTVK
IKLSYVMGGDLESINVEIIK