Protein Info for MMP_RS08225 in Methanococcus maripaludis S2

Annotation: RimK family alpha-L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 262 (261 residues), 162.4 bits, see alignment E=7.2e-52 PF02655: ATP-grasp_3" amino acids 82 to 241 (160 residues), 40.2 bits, see alignment E=7.6e-14 PF02955: GSH-S_ATP" amino acids 89 to 243 (155 residues), 51.2 bits, see alignment E=2.1e-17 PF08443: RimK" amino acids 101 to 262 (162 residues), 85.8 bits, see alignment E=5.9e-28 PF07478: Dala_Dala_lig_C" amino acids 105 to 260 (156 residues), 33.4 bits, see alignment E=6.7e-12

Best Hits

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 100% identity to mmp:MMP1600)

Predicted SEED Role

"Ribosomal protein S6 modification enzyme (glutaminyl transferase) related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWV4 at UniProt or InterPro

Protein Sequence (268 amino acids)

>MMP_RS08225 RimK family alpha-L-glutamate ligase (Methanococcus maripaludis S2)
MKIGILAHKKTPENAMIFEELKKRCSVEFIDPLECFLGSENYDFDLILSRVERDFLTEGI
YTLKDISKDIPVINSAETIQTCQNKYFTYLKLKKVSPKSFLTYSKDISEIFDKIDNNFGY
PFVVKPIYGGYGDGVLKVNSKSEFIEVFEKNEKNELFVQEFVPYIHDIRVFLLNNEIIGS
MERIPKNSWKANYSLGAEIREFKLSNEVEDMVLDSVKKLGADVVGIDVLISKDKNYILEA
NITPQFRGMMNFVNVPKKIADYCINYLK