Protein Info for MMP_RS08220 in Methanococcus maripaludis S2

Annotation: TrkA family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF02254: TrkA_N" amino acids 3 to 118 (116 residues), 108.6 bits, see alignment E=2.5e-35 PF02080: TrkA_C" amino acids 149 to 215 (67 residues), 48.3 bits, see alignment E=7.9e-17

Best Hits

Swiss-Prot: 66% identical to TRKA_METJA: Trk system potassium uptake protein TrkA homolog (trkA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to mmp:MMP1599)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWV5 at UniProt or InterPro

Protein Sequence (221 amino acids)

>MMP_RS08220 TrkA family potassium uptake protein (Methanococcus maripaludis S2)
MYIIVAGMGRVGISLAKSLSGKGHDLVILDQNKKTCEEVAGEIDALVINGDCTKTKSLEN
AGIEDADIFIAVTGNQEINLISGLIAKKFNVSKTIARVSEPDYKDVFESLGIGVVISPEL
VAANYIEKLIDRPGVVDLAIVGRGDAEILELIIPPTSKVADKKIRELGGTKDYVIIAIYE
GNELKIPDGSTELKAYDRILILAKTDSLDEVRKVFSSENKE