Protein Info for MMP_RS08205 in Methanococcus maripaludis S2

Annotation: stage II sporulation protein M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details PF01944: SpoIIM" amino acids 27 to 188 (162 residues), 74.9 bits, see alignment E=3.6e-25

Best Hits

Swiss-Prot: 37% identical to Y706_METJA: Uncharacterized protein MJ0706 (MJ0706) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1596)

Predicted SEED Role

"Uncharacterized protein MJ0706"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWV8 at UniProt or InterPro

Protein Sequence (196 amino acids)

>MMP_RS08205 stage II sporulation protein M (Methanococcus maripaludis S2)
MSKEVYEILEIFDALKRHKNTIYLVSTIFLATFLFSYVFIYYDMFQFRYFGDLMYESFKI
KVQSFSIENKGPFEIIAIILANNLFVAAFTYIIMFFALINIAVNSYLLAYVFYLTNPLEF
ILLIGPHGIFEIPALILAATSGLVLSMSIIKKFRKEKHYKDYFKDSLRIFLVSVTLFVVA
AFVEVLVTYQIALRIA