Protein Info for MMP_RS08180 in Methanococcus maripaludis S2

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF11760: CbiG_N" amino acids 42 to 116 (75 residues), 65.8 bits, see alignment E=2.9e-22 PF01890: CbiG_C" amino acids 193 to 321 (129 residues), 90.7 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 58% identical to CBIG_METJA: Probable cobalt-precorrin-5A hydrolase (cbiG) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02189, cobalamin biosynthesis protein CbiG (inferred from 100% identity to mmp:MMP1591)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWW3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>MMP_RS08180 cobalamin biosynthesis protein (Methanococcus maripaludis S2)
MIKIVYITENAKKLAKDVKSVFDYYFYDNEVFNIKDFEITGNETGFVFIMASGIVLRKYI
PEIQNDKLKDPFVILMDESKKYVVPLLSNHIGGGNYFSDLIGNSLNLNVVKTTATDVNGK
IGIDELSKLYFLENPLKKDIISINKKVLSEKPDLIIPKAWKASKKLLNSYNVSFHDEFHV
LVDDIILKPKTVSLGLGSRRNIEKSKVYWAVKKALYLRDIPSWRIDAFSTVSVKKDEYGI
LKTAERFDKNLFIFEIDEINEIYSKYPLNKSDFVFKTIGTYGVCEPCAILGISKITREKD
FDMKNLVLNKMKKDGVSVSIALQ