Protein Info for MMP_RS08135 in Methanococcus maripaludis S2

Annotation: arginine decarboxylase pyruvoyl-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00286: arginine decarboxylase, pyruvoyl-dependent" amino acids 14 to 163 (150 residues), 190.6 bits, see alignment E=6.7e-61 PF01862: PvlArgDC" amino acids 14 to 162 (149 residues), 147.9 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 100% identical to PDAD_METMP: Pyruvoyl-dependent arginine decarboxylase (pdaD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02626, arginine decarboxylase [EC: 4.1.1.19] (inferred from 96% identity to mmz:MmarC7_0829)

Predicted SEED Role

"Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19)" (EC 4.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWX2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>MMP_RS08135 arginine decarboxylase  pyruvoyl-dependent (Methanococcus maripaludis S2)
MIKSSAIHSPFEAPNTISLVAGTGDANNPLNAFDMSLLKSGIGNLNLIRISSIMPPKADI
IPLPKIPQGSLVPTAYGYQISEIKGETVAAGISVAIPKDKELCGLIMEYECIGGKKECED
TVRNMAKEGFEMRGWEIDEIISIASEHTVENIGCAFAAAALWYK