Protein Info for MMP_RS08095 in Methanococcus maripaludis S2

Annotation: dethiobiotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR00347: dethiobiotin synthase" amino acids 3 to 146 (144 residues), 155.7 bits, see alignment E=6e-50 PF13500: AAA_26" amino acids 3 to 181 (179 residues), 140.5 bits, see alignment E=3.3e-45

Best Hits

Swiss-Prot: 66% identical to BIOD_METVS: ATP-dependent dethiobiotin synthetase BioD (bioD) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 100% identity to mmp:MMP1573)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWY1 at UniProt or InterPro

Protein Sequence (190 amino acids)

>MMP_RS08095 dethiobiotin synthase (Methanococcus maripaludis S2)
LGKILKEQGVNVGYIKPIESGGVEDTTYAKTELELSEDLGLLNPINLKNPLSPNIAAVVE
DVEININKIKESFQKLKESHEYLIVEGAGGVCVPIKTDYLMADLIKDLNLPCVLVTRPDL
GTINHTILSVEYLRNKGILVKGVIINCIDELKNVPYYEETFKAIEEFGNIEIIGVVKNKD
DYSINIEKLL