Protein Info for MMP_RS08060 in Methanococcus maripaludis S2
Annotation: tetrahydromethanopterin S-methyltransferase subunit G
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MTRG_METMP: Tetrahydromethanopterin S-methyltransferase subunit G (mtrG) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K00583, tetrahydromethanopterin S-methyltransferase subunit G [EC: 2.1.1.86] (inferred from 99% identity to mmq:MmarC5_0010)MetaCyc: 35% identical to tetrahydrosarcinapterin S-methyltransferase subunit G (Methanosarcina thermophila)
Tetrahydromethanopterin S-methyltransferase. [EC: 2.1.1.86]
Predicted SEED Role
"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)
MetaCyc Pathways
- methanogenesis from H2 and CO2 (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 II (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 I (5/6 steps found)
- methanogenesis from acetate (4/6 steps found)
- methanogenesis from methoxylated aromatic compounds (1/3 steps found)
- superpathway of methanogenesis (11/21 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.86
Use Curated BLAST to search for 2.1.1.86
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LWY8 at UniProt or InterPro
Protein Sequence (74 amino acids)
>MMP_RS08060 tetrahydromethanopterin S-methyltransferase subunit G (Methanococcus maripaludis S2) MSEIPTVVTPTKDYKRLQAKLDEIENTVENTNAEIIQRTGKKAGRDVGIAYGLAIGFIFV YVLGTVLPLFDLIK