Protein Info for MMP_RS08050 in Methanococcus maripaludis S2

Annotation: tetrahydromethanopterin S-methyltransferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 218 to 238 (21 residues), see Phobius details TIGR01111: tetrahydromethanopterin S-methyltransferase, subunit A" amino acids 1 to 239 (239 residues), 361.9 bits, see alignment E=8.1e-113 PF04208: MtrA" amino acids 4 to 173 (170 residues), 267.4 bits, see alignment E=2.4e-84

Best Hits

Swiss-Prot: 100% identical to MTRA_METMP: Tetrahydromethanopterin S-methyltransferase subunit A (mtrA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00577, tetrahydromethanopterin S-methyltransferase subunit A [EC: 2.1.1.86] (inferred from 100% identity to mmp:MMP1564)

MetaCyc: 54% identical to tetrahydromethanopterin S-methyltransferase subunit A (Methanothermobacter thermautotrophicus)

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit A (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.86

Use Curated BLAST to search for 2.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWZ0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>MMP_RS08050 tetrahydromethanopterin S-methyltransferase subunit A (Methanococcus maripaludis S2)
MADKKAPAAGWPVANGEYVVGNPESCVAVVTLGSHGLDQAAIDAGAAISGPCHTENLGIE
KVVANYISNPNIRFMVITGSEVQGHITGQCIKALYENGIGDDGGIIGAKGAIPFMENVGT
EPVGRLQSQIVECIDLIDVEDTGKISDAIKNCISKDPGAFEEEPMVIELEGGAAAAGEES
TSIKPTSPEMALLEARMRIVSEKMNEAAMIAKFNSGYYNGKIQGIAIGLFLSIVIFSLL