Protein Info for MMP_RS08015 in Methanococcus maripaludis S2

Annotation: methyl-coenzyme M reductase I operon protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR03264: methyl-coenzyme M reductase I operon protein C" amino acids 4 to 197 (194 residues), 352.5 bits, see alignment E=2.4e-110 PF04609: MCR_C" amino acids 37 to 147 (111 residues), 35.9 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 94% identical to MCRC_METVA: Methyl-coenzyme M reductase operon protein C (mcrC) from Methanococcus vannielii

KEGG orthology group: K03421, methyl-coenzyme M reductase subunit C (inferred from 100% identity to mmp:MMP1557)

Predicted SEED Role

"Methyl coenzyme M reductase operon protein C" in subsystem Methanogenesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWZ7 at UniProt or InterPro

Protein Sequence (198 amino acids)

>MMP_RS08015 methyl-coenzyme M reductase I operon protein C (Methanococcus maripaludis S2)
MPVGRKEQIVDCRAVMGLGEGGGLAQRGTFAEGLRNDVVVVAMSPGRRHITKPVCEITYG
IREAGIQTSVLVLDAGGGIPSDAPQGSLGSTFGLKPEEAKQVNRHKLCVIHFGNVKSHII
YKARLFLKYVDIPTIIVCQTPVDMEDFAAIGIKTKNVMPLESKTEGKIVEIITGVIRGES
APQKKIDEIIESIKKHLG