Protein Info for MMP_RS07965 in Methanococcus maripaludis S2

Annotation: NADPH-dependent F420 reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR01915: NADPH-dependent F420 reductase" amino acids 1 to 218 (218 residues), 275.8 bits, see alignment E=1.6e-86 PF03807: F420_oxidored" amino acids 2 to 101 (100 residues), 64.9 bits, see alignment E=4.1e-22

Best Hits

Swiss-Prot: 67% identical to FNO_METJA: F420-dependent NADP reductase (fno) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06988, (no description) (inferred from 100% identity to mmp:MMP1550)

Predicted SEED Role

"NADPH-dependent F420 reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX04 at UniProt or InterPro

Protein Sequence (223 amino acids)

>MMP_RS07965 NADPH-dependent F420 reductase (Methanococcus maripaludis S2)
MKIAILGGTGDQGFGLALRFSKNHEILIGSRKAEKAIEASENALKIISDKGYSADIKGMT
NLEASKLADVVIVSLPFEYTISTIKELKEALKGKIVVSIGVPLATAIGDKPTRVIACPQG
SVAELIQEMLPESKVVSGFQNICSKCLEDLDCEVACDVLIAGNDSDAKKVIVELASEIPG
VRGIDAGKLEISKFIEQITPLLIQLNIKYKLKGAGIHITGLNL