Protein Info for MMP_RS07925 in Methanococcus maripaludis S2

Annotation: haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF01997: Translin" amino acids 17 to 173 (157 residues), 37 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K07477, translin (inferred from 100% identity to mmp:MMP1542)

Predicted SEED Role

"Uncharacterized protein MJ0175"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX11 at UniProt or InterPro

Protein Sequence (196 amino acids)

>MMP_RS07925 haloacid dehalogenase (Methanococcus maripaludis S2)
VKNSSYLLEFFEKKNETREKILKISREIVKDSGLIIRKTQKGETVDFSDIEEKLNKLKNY
SENHFEFQKYRGTPEQEYVEARVYYSIIFENKILNFSDFESTLEENYILGLCDVIGELRR
ITLESIRKDEKTKAELYFEYMNRIYDFLMEFDNYHVIDGLRRKQDVSRSLIEKTHGDIVN
FNENLKLRTELSKFNK