Protein Info for MMP_RS07895 in Methanococcus maripaludis S2

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 98% identity to mmz:MmarC7_0785)

Predicted SEED Role

"Uncharacterized protein MJ1590"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX16 at UniProt or InterPro

Protein Sequence (151 amino acids)

>MMP_RS07895 cytochrome c (Methanococcus maripaludis S2)
MKVSPLQTGLIAGFSAILLEVIFKVSPPPAYGLCVACHTRDLVNWIVNSVAGTTLGMAPV
SKLIPLLTVVGLLIGALIGAIVHKDFKIRKTHGLVTGFILGFLVLNFALLMGGCPVRMGL
RTAYGDLFGLLGILGIAAGVIVSTEVYLKKA