Protein Info for MMP_RS07885 in Methanococcus maripaludis S2

Annotation: tripartite tricarboxylate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 176 to 192 (17 residues), see Phobius details amino acids 215 to 243 (29 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details amino acids 379 to 395 (17 residues), see Phobius details PF01970: TctA" amino acids 4 to 383 (380 residues), 143.7 bits, see alignment E=3.5e-46

Best Hits

Swiss-Prot: 52% identical to Y1079_METJA: Uncharacterized protein MJ1079 (MJ1079) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K08971, putative membrane protein (inferred from 100% identity to mmp:MMP1535)

Predicted SEED Role

"Uncharacterized protein MJ1079"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX18 at UniProt or InterPro

Protein Sequence (397 amino acids)

>MMP_RS07885 tripartite tricarboxylate transporter permease (Methanococcus maripaludis S2)
INNLFFLIFGIATGTITGLIPGIHPNTLIPISVISYPYFGSSNYFSFLIGLLISHYFLNY
IPSAFIGVPDDESAVAAVPMHNLTILGRGYEAVVLAGFGAFFGIICSIFLFLVISTINID
FQSFYSGLKPFLPYILILFLLISVIFSKNRLWTTLIILFSGILGIIVFYKNLSFDYSLTV
IFTGMFGIPLLFENLNKKELGNQFISFPELKLSYLKSAVFGTLGGFFRIFIPATGGAQIN
YFLSKLIKEENIENFIISQGSITLSNELFSILALMMIGTGRSGISEAIKSLNIEYTQSEL
FSSVLIATGISFLSLTVISKYFLQNINKFDYGLISKVLIVFCTILVVILSFKAYLIYHVV
IYLISISIGVLCVKKRVNLSNMMGVLIFPTILYFLKI