Protein Info for MMP_RS07840 in Methanococcus maripaludis S2

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02191: ribonuclease III" amino acids 9 to 224 (216 residues), 229.1 bits, see alignment E=2.4e-72 PF14622: Ribonucleas_3_3" amino acids 19 to 146 (128 residues), 126.2 bits, see alignment E=1.4e-40 PF00636: Ribonuclease_3" amino acids 43 to 132 (90 residues), 90.9 bits, see alignment E=1.2e-29 PF00035: dsrm" amino acids 159 to 224 (66 residues), 54.9 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 48% identical to RNC_BACSK: Ribonuclease 3 (rnc) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to mmp:MMP1526)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX27 at UniProt or InterPro

Protein Sequence (229 amino acids)

>MMP_RS07840 ribonuclease III (Methanococcus maripaludis S2)
MKNFEKLLSKLDIQFNDLNIFKRAFMHSSYVNEQKNTNLEDNERLEYLGDAVLDLIISEY
LFKKENLSEGEMSKLRAKYVCESALFTYAKKLKFNNYVLLGKGEINSKGYNKPAIVSDVF
EAFIAAIYLDQGLDSVKKFVYEFIIPIIEESSKELFIDYKTKLQEFPELINKSINYVNLE
ETGEAHDKKFVIAVKSGRKILGKGIGKSKKEAEMKAAKNALLKLEKNKN