Protein Info for MMP_RS07825 in Methanococcus maripaludis S2

Annotation: preprotein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF07549: Sec_GG" amino acids 22 to 45 (24 residues), 25.4 bits, see alignment (E = 1.1e-09) PF21760: SecD_1st" amino acids 54 to 103 (50 residues), 28.2 bits, see alignment 1.5e-10 PF02355: SecD_SecF_C" amino acids 219 to 372 (154 residues), 60.2 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 65% identical to SECD_METJA: Protein-export membrane protein SecD (secD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 100% identity to mmp:MMP1523)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX30 at UniProt or InterPro

Protein Sequence (388 amino acids)

>MMP_RS07825 preprotein translocase subunit SecD (Methanococcus maripaludis S2)
MKLLKDHKVVILLVCVLASLLLIAFKGISFGVDLSGGSTIVLQTESELSESEMTTVNEIL
TSRLNTNGLSDVRIYPRGSDEIVIEIPESADLERIQKILTQQGVFTAVIDNQTAYTGQDV
SYVEEPGMTASGYGVGFKLTLDGAQKFADVAYGKGGYPVELYMDEKAISAPLLSADLADG
NIHQNQVITVAGSNPTEEDIDEAWVIYTALKSGSLPVKVHIEYISSVSPTLGSEFIKGSV
IAGIFAFIAVAAVISFRYKNPKIVLPILITGFSEVLLILGFASLIDWKLDLASIAGIIAA
VGTGVDHQIVITDETISGEAKKVTKSIKRAFFIIFGAAATTIAAMLPLFVMGIGMLKGFA
ITTIAGVLMGISISRPAFSRIIQYVLKH