Protein Info for MMP_RS07785 in Methanococcus maripaludis S2

Annotation: TCP-1/cpn60 chaperonin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 TIGR02339: thermosome, various subunits, archaeal" amino acids 7 to 518 (512 residues), 758.4 bits, see alignment E=2.1e-232 PF00118: Cpn60_TCP1" amino acids 31 to 519 (489 residues), 626.7 bits, see alignment E=1.4e-192

Best Hits

Swiss-Prot: 86% identical to THS_METTL: Thermosome subunit (ths) from Methanothermococcus thermolithotrophicus

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1515)

Predicted SEED Role

"Heat shock protein 60 family chaperone GroEL / Thermosome subunit" in subsystem GroEL GroES or Staphylococcal pathogenicity islands SaPI or Thermosome, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX38 at UniProt or InterPro

Protein Sequence (543 amino acids)

>MMP_RS07785 TCP-1/cpn60 chaperonin family protein (Methanococcus maripaludis S2)
MSQQPGVLPENMKRYMGRDAQRMNILAGRIIAETVRSTLGPKGMDKMLVDDLGDVVVTND
GVTILREMSVEHPAAKMLIEVAKTQEKEVGDGTTTAVVVAGELLRKAEELLDQNVHPTIV
VKGYQAAAQKAQELLKTIACEVGAQDKEILTKIAMTSITGKGAEKAKEKLAEIIVEAVSA
VVDDEGKVDKDLIKIEKKSGASIDDTELIKGVLVDKERVSAQMPKKVTDAKIALLNCAIE
IKETETDAEIRITDPAKLMEFIEQEEKMLKDMVAEIKASGANVLFCQKGIDDLAQHYLAK
EGIVAARRVKKSDMEKLAKATGANVITNIKDLSAQDLGDAGLVEERKISGDSMIFVEECK
HPKAVTMLIRGTTEHVIEEVARAVDDAVGVVGCTIEDGRIVSGGGSTEVELSMKLREYAE
GISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKVRAAHASNGNKCAGLNVFTGAV
EDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAAEKLRGAPDMGDMGGMPGMGGMP
GMM