Protein Info for MMP_RS07765 in Methanococcus maripaludis S2

Annotation: sodium:alanine symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 15 to 441 (427 residues), 502.7 bits, see alignment E=4.3e-155 PF01235: Na_Ala_symp" amino acids 53 to 451 (399 residues), 468.1 bits, see alignment E=1.4e-144

Best Hits

Swiss-Prot: 100% identical to AGCS_METMP: Sodium/alanine symporter AgcS (agcS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to mmp:MMP1511)

Predicted SEED Role

"Amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX42 at UniProt or InterPro

Protein Sequence (453 amino acids)

>MMP_RS07765 sodium:alanine symporter family protein (Methanococcus maripaludis S2)
MDFVSLVNTVNSFVWGPYMLVLLLGTGIFLTLRLGFMQIHTLPYALKLAFSKHQDETSEG
DISHFQALMTALAATIGTGNIAGVATAYVLGGPGAIFWMWVTAFFGMATKYAEAVLAIKY
RTVDDNGEMAGGPMYFLEKGLPDHGLGKILGVAFAFFGAFAAFGIGNMVQTNSVADAVAS
NFGVDPLITGFVLAIFTAAVILGGIKSIGKATGIIVPFMAVFYILAGLVILAMNIGYIIP
AFGTIFSSAFNFSAGFGALIGTAIMWGVKRGVFSNEAGLGSAPIAAAAAKTDHPGRQALV
SMTGTFLDTIVVCTITGLVLTIAGLKAFPGLTDLTGASLTAASFDALMPMGGLIVTIGLV
FFAYSTVLGWSYYGEKCFEYLIGTKGIRLYRIAFVLVAFWGATASLPLVWNIADTLNGAM
AIPNLIGLLLLSGVVVSETKAFNEIRKNEAKNA