Protein Info for MMP_RS07725 in Methanococcus maripaludis S2

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13247: Fer4_11" amino acids 38 to 120 (83 residues), 50.5 bits, see alignment E=1e-16 PF12838: Fer4_7" amino acids 44 to 89 (46 residues), 30 bits, see alignment E=3e-10 PF25160: LdpA_Fe-S-bd" amino acids 49 to 91 (43 residues), 34.3 bits, see alignment E=8.4e-12 PF12797: Fer4_2" amino acids 67 to 87 (21 residues), 30 bits, see alignment (E = 1.6e-10) PF00037: Fer4" amino acids 68 to 91 (24 residues), 39.9 bits, see alignment 1.2e-13 PF12837: Fer4_6" amino acids 71 to 90 (20 residues), 31.8 bits, see alignment (E = 4.7e-11) PF12798: Fer4_3" amino acids 75 to 89 (15 residues), 18 bits, see alignment (E = 2.1e-06)

Best Hits

Swiss-Prot: 62% identical to FER9_METJA: Uncharacterized ferredoxin MJ0265 (MJ0265) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00196, carbon-monoxide dehydrogenase iron sulfur subunit (inferred from 100% identity to mmp:MMP1503)

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, porE subunit (EC 1.2.7.1)" in subsystem Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX49 at UniProt or InterPro

Protein Sequence (167 amino acids)

>MMP_RS07725 4Fe-4S dicluster domain-containing protein (Methanococcus maripaludis S2)
MKKVMMVNEACDNCGDCVKSCSEVHEVSGISIWEHEGRYLPVVCQHCTSSPCMEVCPVSA
IESKDGVIYLDKESCIGCGLCAMACPFGAIYISGKTAHKCDLCFGRDEQACVKACSKRCL
EVVNVDELVMDKKLNNIENLTVLGSKGKSKKKKGLLSLVTASSRCNP