Protein Info for MMP_RS07720 in Methanococcus maripaludis S2

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF00037: Fer4" amino acids 6 to 25 (20 residues), 24.8 bits, see alignment 7.2e-09 amino acids 59 to 82 (24 residues), 36.6 bits, see alignment 1.4e-12 PF13247: Fer4_11" amino acids 31 to 114 (84 residues), 50.9 bits, see alignment E=7.6e-17 PF13237: Fer4_10" amino acids 33 to 77 (45 residues), 24.8 bits, see alignment E=8.2e-09 amino acids 58 to 109 (52 residues), 27.8 bits, see alignment E=1e-09 PF12838: Fer4_7" amino acids 34 to 80 (47 residues), 34.3 bits, see alignment E=1.4e-11 PF12798: Fer4_3" amino acids 35 to 51 (17 residues), 13.2 bits, see alignment (E = 7.1e-05) amino acids 66 to 80 (15 residues), 17.7 bits, see alignment (E = 2.5e-06) PF12837: Fer4_6" amino acids 59 to 81 (23 residues), 26.3 bits, see alignment 2.7e-09

Best Hits

Swiss-Prot: 53% identical to Y264_METJA: Uncharacterized protein MJ0264 (MJ0264) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00196, carbon-monoxide dehydrogenase iron sulfur subunit (inferred from 100% identity to mmp:MMP1502)

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, porF subunit (EC 1.2.7.1)" in subsystem Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX50 at UniProt or InterPro

Protein Sequence (138 amino acids)

>MMP_RS07720 4Fe-4S binding protein (Methanococcus maripaludis S2)
MKVMPNIDLCVDCKKCERACPINAIHVFDGIPIRCMHCEDAPCLNVCPEDAIEKIADKVV
VHPEKCVGCALCAEVCPVGAIQIDRGTKVAVKCDGCIERGSEVCLEVCPTKALDYYENTI
ENKRAELVSKLKKLTSRK