Protein Info for MMP_RS07715 in Methanococcus maripaludis S2

Annotation: YfcE family phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF12850: Metallophos_2" amino acids 1 to 152 (152 residues), 110.8 bits, see alignment E=6.7e-36 TIGR00040: phosphodiesterase, MJ0936 family" amino acids 1 to 157 (157 residues), 155.3 bits, see alignment E=6.7e-50 PF00149: Metallophos" amino acids 3 to 73 (71 residues), 27.3 bits, see alignment E=4.7e-10

Best Hits

Swiss-Prot: 53% identical to Y623_METJA: Putative metallophosphoesterase MJ0623 (MJ0623) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07095, (no description) (inferred from 100% identity to mmp:MMP1501)

Predicted SEED Role

"Predicted phosphoesterase MJ0623"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX51 at UniProt or InterPro

Protein Sequence (163 amino acids)

>MMP_RS07715 YfcE family phosphodiesterase (Methanococcus maripaludis S2)
MIIGIISDTHIPERAKKLPKEIFEHFSDVDLIIHCGDVTSESVLNDLEKISELLVVSGNM
DYMNYPKEYEITIENFKIGIIHGNQIHPRGDTLKMKYLCLEKNWDILISGHTHIPMIKEI
SLENKKILLLNPGSPTVPRYPLKTIMKLKIEEREIDAELISIK