Protein Info for MMP_RS07710 in Methanococcus maripaludis S2

Annotation: cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00065: cell division protein FtsZ" amino acids 18 to 344 (327 residues), 429.2 bits, see alignment E=7e-133 PF00091: Tubulin" amino acids 29 to 188 (160 residues), 161.7 bits, see alignment E=2.7e-51 PF12327: FtsZ_C" amino acids 236 to 333 (98 residues), 111 bits, see alignment E=2.8e-36

Best Hits

Swiss-Prot: 72% identical to FTSZ2_METJA: Cell division protein FtsZ 2 (ftsZ2) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to mmp:MMP1500)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX52 at UniProt or InterPro

Protein Sequence (365 amino acids)

>MMP_RS07710 cell division protein FtsZ (Methanococcus maripaludis S2)
MRLVKEALSKNNEELYNTQMAKDDFGNAKILVVGCGGAGNNTIHRLSEIGIEGAETIAIN
TDKQHLEHINADKKILIGSTLTRGLGAGGYPEIGKKSAELAKNVLEDVIKSADLIFVAAG
MGGGTGTGSAPVVAEIAKENGAVVIGVVTYPFKIERARLKKADEGLRRLTECCDTVIVID
NNRLVDFVPNLPMNEAFRVADEIIAQAVKGITETISLKSLINIDYADVKAVMTNGGVAMI
GVGEVDYDTKGDRVEKVVKDTLQCPLLDIDYKGATGALIHITGGPDLTLGEANRIGDGIT
SSMDINANVIWGARLDPSMDGAIRVMAIITGVKSPNIMGGGKSHQKIIPNSANRSKGSLG
IDYIV