Protein Info for MMP_RS07685 in Methanococcus maripaludis S2

Annotation: TIGR01212 family radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR01212: radical SAM protein, TIGR01212 family" amino acids 32 to 331 (300 residues), 381.4 bits, see alignment E=1.3e-118 PF04055: Radical_SAM" amino acids 66 to 229 (164 residues), 59.1 bits, see alignment E=6.4e-20 PF16199: Radical_SAM_C" amino acids 236 to 319 (84 residues), 85.7 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 64% identical to Y486_METJA: Uncharacterized protein MJ0486 (MJ0486) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07139, (no description) (inferred from 100% identity to mmp:MMP1495)

Predicted SEED Role

"COG1242: Predicted Fe-S oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX57 at UniProt or InterPro

Protein Sequence (332 amino acids)

>MMP_RS07685 TIGR01212 family radical SAM protein (Methanococcus maripaludis S2)
MNRGARIYRTNSGSIDKNIVDKIYSEGFPITQYGLYTKREKGYKTFKVAVDAGFSCPNKD
GTIDTEGCIFCPKMGRVISVEYCNVKYSLKEQIEHQIRRNKEKGIEKFYVYFYPGTNTHA
SPEYLKELWDFALSFDDVLGISIGTRPDCLEDEKLDILENYVKEGYEIWIDLGIQTMHDK
TLDFLNRKHSSDDVRRVLLECKKRGILVCGHIILGLPDESWDMMMETAKILSDLEIDALK
IYPLVVVENTKLEEIYWKGEYKSLDEKQYIHLVADFLEHISKYVIIQRVSKDKVPEEIKI
SPEWSLKRLRILNEVSKLLDKRKTKQGSKYKK