Protein Info for MMP_RS07650 in Methanococcus maripaludis S2

Annotation: TldD/PmbA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF01523: PmbA_TldD_1st" amino acids 24 to 87 (64 residues), 48.1 bits, see alignment E=1.6e-16 PF19290: PmbA_TldD_2nd" amino acids 118 to 222 (105 residues), 51.1 bits, see alignment E=2.5e-17 PF19289: PmbA_TldD_3rd" amino acids 230 to 452 (223 residues), 230.5 bits, see alignment E=2.2e-72

Best Hits

Swiss-Prot: 67% identical to Y996_METJA: Metalloprotease MJ0996 (MJ0996) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to mmp:MMP1488)

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX64 at UniProt or InterPro

Protein Sequence (458 amino acids)

>MMP_RS07650 TldD/PmbA family protein (Methanococcus maripaludis S2)
VSFLNDLDLNIEKLEKLLEIGTYADLRIVTGESNNIIQKDGIIDEISSGISSGVIVRVLE
KNGWGLATSNSVSLKNIEEIIKKAQGMAKISNIHTKKSIELKEIPIIQDNTKADVKIHPE
NISIEEKKEYLKSAHENMSGEKIVSTSVSYSDGEGHSILMTSEGTRIENESVKALLRMTA
IAKDGTLQFAFDRIGGNGFEVIKNAKIEEMAKNTKERAVRLLTAESCPKGTFDVILDPEL
AGVFIHEAVGHAAEADLVLQNDSVFHDKLGNSVGSEEVTVIDDATIEKSFGQYKYDHEGV
KGEKTTLIEDGVLNGYLHSRETAGRLNMDVTGNARAEGLNKPIVRMSNTYIKPGSWKFDE
LLEDTKTGIFLKGSRGGQVDTGKGLFQFNAVEAFLIEDGKLTKPLRDAGLSGEILDILHH
IDAVSDEFELSVGYCGKGGQSVPVGDGGGSVRTKTTLS